springfieldidealfamilyweightloss.com valuation and analysis

Robots.txt Information
Robot Path Permission
GoogleBot / ✔
BingBot / ✔
BaiduSpider / ✔
YandexBot / ✔ 
User-agent: * Disallow: /wp-admin/ Allow: /wp-admin/admin-ajax.php Sitemap:
Meta Tags
Title Ideal Family Weight Loss Center, LLC | Ideal Protein - Lose Weight and Learn How to Maintain a
Description All the POWER you need to lose weight exists inside (703) 989-7408 idealfamilyspringfield@gmail.com Facebook Facebook Home About Us Our Clinic Our Team Ideal Protein The Protocol Products Services Ideal Pro
Keywords N/A
Server Information
WebSite springfieldidealfamilyweightloss faviconspringfieldidealfamilyweightloss.com
Host IP 172.105.111.14
Location -
Related Websites
Site Rank
More to Explore
springfieldidealfamilyweightloss.com Valuation
US$302,709
Last updated: 2023-05-13 18:04:21

springfieldidealfamilyweightloss.com has Semrush global rank of 34,965,281. springfieldidealfamilyweightloss.com has an estimated worth of US$ 302,709, based on its estimated Ads revenue. springfieldidealfamilyweightloss.com receives approximately 34,928 unique visitors each day. Its web server is located in -, with IP address 172.105.111.14. According to SiteAdvisor, springfieldidealfamilyweightloss.com is safe to visit.

Traffic & Worth Estimates
Purchase/Sale Value US$302,709
Daily Ads Revenue US$280
Monthly Ads Revenue US$8,383
Yearly Ads Revenue US$100,593
Daily Unique Visitors 2,329
Note: All traffic and earnings values are estimates.
DNS Records
Host Type TTL Data
springfieldidealfamilyweightloss.com. 300 IN A A IP: 172.105.111.14
springfieldidealfamilyweightloss.com. 300 IN NS NS NS Record: ns3.systemdns.com.
springfieldidealfamilyweightloss.com. 300 IN NS NS NS Record: ns2.systemdns.com.
springfieldidealfamilyweightloss.com. 300 IN NS NS NS Record: ns1.systemdns.com.
HtmlToTextCheckTime:2023-05-13 18:04:21
(703) 989-7408 idealfamilyspringfield@gmail.com Facebook Facebook Home About Us Our Clinic Our Team Ideal Protein The Protocol Products Services Ideal Protein Platform Family Chiropractic Family Counselling Contact Contact Form Locations Select Page The Protocol Our medically developed weight loss protocol and smarter lifestyle choices education offers dieters what they really want…a structured program that can put an end to constant dieting. Learn More! Home Page 1 All the POWER you need to lose weight exists inside you. Typical diet programs recommend or require you to eat in ways that you can’t and don’t want to sustain for the rest of your life. These diets will have you eat foods you may not like very much and don’t find satisfying. You may stick with it long enough to achieve your weight loss goal, but without an educated change to your eating and lifestyle habits, it’s likely you will backslide into previous eating patterns and gain back more weight than you originally lost.
HTTP Headers
HTTP/1.1 301 Moved Permanently
Server: nginx-rc
Date: Tue, 21 Dec 2021 21:14:15 GMT
Content-Type: text/html
Content-Length: 174
Connection: keep-alive
Location: https://springfieldidealfamilyweightloss.com/

HTTP/2 200 
server: nginx-rc
date: Tue, 21 Dec 2021 21:14:17 GMT
content-type: text/html; charset=UTF-8
vary: Accept-Encoding
link: ; rel="https://api.w.org/", ; rel="alternate"; type="application/json", ; rel=shortlink
x-et-api-version: v1
x-et-api-root: https://springfieldidealfamilyweightloss.com/wp-json/tribe/tickets/v1/
x-et-api-origin: https://springfieldidealfamilyweightloss.com
x-tec-api-version: v1
x-tec-api-root: https://springfieldidealfamilyweightloss.com/wp-json/tribe/events/v1/
x-tec-api-origin: https://springfieldidealfamilyweightloss.com
x-frame-options: SAMEORIGIN
x-xss-protection: 1; mode=block
x-content-type-options: nosniff
springfieldidealfamilyweightloss.com Whois Information
Domain Name: SPRINGFIELDIDEALFAMILYWEIGHTLOSS.COM
Registry Domain ID: 1911375884_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.tucows.com
Registrar URL: http://www.tucows.com
Updated Date: 2021-02-18T05:03:40Z
Creation Date: 2015-03-19T16:33:34Z
Registry Expiry Date: 2022-03-19T16:33:34Z
Registrar: Tucows Domains Inc.
Registrar IANA ID: 69
Registrar Abuse Contact Email: domainabuse@tucows.com
Registrar Abuse Contact Phone: +1.4165350123
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS1.SYSTEMDNS.COM
Name Server: NS2.SYSTEMDNS.COM
Name Server: NS3.SYSTEMDNS.COM
DNSSEC: unsigned
>>> Last update of whois database: 2021-12-25T07:27:19Z <<<

Copyright © 2022 WebZZ.US 0.0221